DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and Chadl

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:XP_038936217.1 Gene:Chadl / 100910434 RGDID:6504353 Length:747 Species:Rattus norvegicus


Alignment Length:749 Identity:177/749 - (23%)
Similarity:262/749 - (34%) Gaps:219/749 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPDHTRVTATTRSRPWLCGAIPVLLLLLLTLVILPPETTAF--CPSKCQCLGGEANSR--ALCVD 61
            || |.:..:.:..||      ....||||.:.:.|....|.  ||..|.|    .|||  ..|..
  Rat     1 MP-HGQQLSLSSPRP------QSFTLLLLMMFLSPAWNVAAQRCPQTCVC----DNSRRHVTCQH 54

  Fly    62 AALEDVPIQLNPETKYINLTVNRIRTLEFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLN 126
            ..|.:||..: ||     ||                 :.|||..|:::.:....|:....|..|:
  Rat    55 QNLTEVPDTI-PE-----LT-----------------QRLDLQGNMLKVIPPAAFQDLPYLTHLD 96

  Fly   127 LSRNLVSSLHKHAFKGLTNLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGM 191
            |....|..:.:.||:||..||.|:|:.||:.::...||..|.||..|:|..|.:..|....|..:
  Rat    97 LQHCQVEQVAEGAFRGLGRLLFLNLASNRLSSLPQEALDGLGSLRRLELERNMLEELRPGTFGAL 161

  Fly   192 NTLEVLVFRNNRLLDVPASNLWHLHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELD 256
            .:|..|...:|.|:.:||.                        :|:||.....|.:..|.:|.|.
  Rat   162 GSLATLNLAHNALVYLPAM------------------------AFQGLMRTRWLQLSHNALSVLA 202

  Fly   257 LSAFEGLISLKHLDLSDNNLTMVPTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSR 321
            ..|..||..|:.|.|..|.|..:|...||:..:|..|.||.|..:.......|.|..||||.|..
  Rat   203 PEALAGLPVLRRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLRELALDH 267

  Fly   322 LDFLQRIDSRAFVDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQ 386
             ..||.:..|||.....|.||.|                         :.|.|.||...|.| .|
  Rat   268 -GSLQALGPRAFAHCPRLHTLDL-------------------------RGNQLTTLPPLQVP-GQ 305

  Fly   387 LQKLYLGDNPLQCNCS----LLWLWRLVTGNFEGVDPGMEHAAGGAVAAL----------AKEAD 437
            |::|.|..|||.|.|.    |.||.|....: :|...|.....|..:..|          |.|.:
  Rat   306 LRRLRLQGNPLWCACHARPLLEWLVRARVRS-DGACRGPRRLRGETLDTLRPSDLRCPGDAAEDE 369

  Fly   438 DEE-----------LADEA---------------TAVASTDD-GVAAL----------------- 458
            ||:           |.:||               |..::.|. |:.|:                 
  Rat   370 DEDRPAGPRSPPRSLHEEARWATPCPPACVCVGETRHSACDGRGLQAVPRGFPNDTQLLDLRRNH 434

  Fly   459 ------AAYIAEQHIVNALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRTRRKLLT 517
                  ||:...:|:| :||.......||...:.....|::                     .|.
  Rat   435 FPSVPRAAFPGLRHLV-SLHLQHCGIAELEPGALAGLDGLV---------------------YLY 477

  Fly   518 MSEGEITCPAHIVTVVCAVITCLLVAMIGISVLYYLRFVKRRRKLLHERGPMRTSKSIINVH--- 579
            :|..:::             .....|:.|...|.|| :::..|.|......:|....:.::|   
  Rat   478 LSNNQLS-------------GLSAAALEGAPNLGYL-YLEHNRFLRIPGAALRALPRLFSLHLQD 528

  Fly   580 ---DRILQGHNPGGLGL-GMSMTLGGGNHVNGLGM-TLNYPHHAQTLQAHHHYHQAMPLQSHGGN 639
               ||:..|...|...| |:.::   |||:..:.. .|......:.|....:..:.:|..:..| 
  Rat   529 NAVDRLAPGDLAGARALRGLYLS---GNHITQVSPGALGPARELEKLHLDRNQLRQVPTGALEG- 589

  Fly   640 GNHEYQQTTLPQLDKLELERYLAAQTIANEYRAL 673
                     ||.|.:|:|.|        |.:|||
  Rat   590 ---------LPALKELQLSR--------NPFRAL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 2/21 (10%)
leucine-rich repeat 98..121 CDD:275380 5/22 (23%)
LRR_8 120..180 CDD:404697 22/59 (37%)
leucine-rich repeat 122..145 CDD:275380 8/22 (36%)
leucine-rich repeat 146..169 CDD:275380 9/22 (41%)
LRR <161..>354 CDD:227223 55/192 (29%)
leucine-rich repeat 170..193 CDD:275380 6/22 (27%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..265 CDD:275380 10/46 (22%)
leucine-rich repeat 266..289 CDD:275380 8/22 (36%)
leucine-rich repeat 290..313 CDD:275380 7/22 (32%)
leucine-rich repeat 314..338 CDD:275380 10/23 (43%)
LRR_8 337..397 CDD:404697 15/59 (25%)
leucine-rich repeat 339..360 CDD:275380 4/20 (20%)
ChadlXP_038936217.1 PLN00113 30..>555 CDD:215061 152/642 (24%)
leucine-rich repeat 48..66 CDD:275380 4/18 (22%)
leucine-rich repeat 68..91 CDD:275380 6/39 (15%)
leucine-rich repeat 92..115 CDD:275380 8/22 (36%)
leucine-rich repeat 116..139 CDD:275380 9/22 (41%)
leucine-rich repeat 140..163 CDD:275380 6/22 (27%)
leucine-rich repeat 164..187 CDD:275380 9/46 (20%)
leucine-rich repeat 188..211 CDD:275380 7/22 (32%)
leucine-rich repeat 212..235 CDD:275380 8/22 (36%)
leucine-rich repeat 236..259 CDD:275380 7/22 (32%)
leucine-rich repeat 260..283 CDD:275380 10/23 (43%)
leucine-rich repeat 306..345 CDD:275380 14/39 (36%)
leucine-rich repeat 425..448 CDD:275380 2/22 (9%)
PPP1R42 446..603 CDD:411060 38/213 (18%)
leucine-rich repeat 449..472 CDD:275380 5/23 (22%)
leucine-rich repeat 473..496 CDD:275380 4/56 (7%)
leucine-rich repeat 497..520 CDD:275380 6/23 (26%)
leucine-rich repeat 521..544 CDD:275380 5/22 (23%)
leucine-rich repeat 545..568 CDD:275380 6/25 (24%)
leucine-rich repeat 569..592 CDD:275380 4/32 (13%)
LRR_8 591..653 CDD:404697 9/24 (38%)
leucine-rich repeat 593..617 CDD:275380 8/22 (36%)
leucine-rich repeat 618..641 CDD:275380
leucine-rich repeat 643..665 CDD:275380
leucine-rich repeat 666..677 CDD:275378
LRRCT 673..721 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.