| Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001182474.1 | Gene: | LRRC3C / 100505591 | HGNCID: | 40034 | Length: | 275 | Species: | Homo sapiens |
| Alignment Length: | 264 | Identity: | 65/264 - (24%) |
|---|---|---|---|
| Similarity: | 94/264 - (35%) | Gaps: | 94/264 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 272 SDNNLTMVPTQQLSKLSNLT-YLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAF-- 333
Fly 334 VDNTHLQTLHLNNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQ 398
Fly 399 CNCSL---LWLWRLVTGNFEGVDPGMEHAAGGAVAALAKE----ADDEELADEATAVASTDDGVA 456
Fly 457 AL----------AAYIAEQHIVNALHTTEPSAYELATSSSNRNSGILRMDRQQIGCDIWRDKVRT 511
Fly 512 RRKL 515 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | |
| leucine-rich repeat | 98..121 | CDD:275380 | |||
| LRR_8 | 120..180 | CDD:404697 | |||
| leucine-rich repeat | 122..145 | CDD:275380 | |||
| leucine-rich repeat | 146..169 | CDD:275380 | |||
| LRR | <161..>354 | CDD:227223 | 30/84 (36%) | ||
| leucine-rich repeat | 170..193 | CDD:275380 | |||
| leucine-rich repeat | 194..217 | CDD:275380 | |||
| leucine-rich repeat | 218..265 | CDD:275380 | |||
| leucine-rich repeat | 266..289 | CDD:275380 | 5/16 (31%) | ||
| leucine-rich repeat | 290..313 | CDD:275380 | 9/23 (39%) | ||
| leucine-rich repeat | 314..338 | CDD:275380 | 8/25 (32%) | ||
| LRR_8 | 337..397 | CDD:404697 | 14/59 (24%) | ||
| leucine-rich repeat | 339..360 | CDD:275380 | 8/20 (40%) | ||
| LRRC3C | NP_001182474.1 | leucine-rich repeat | 61..80 | CDD:275378 | 5/17 (29%) |
| LRR 1 | 80..101 | 8/20 (40%) | |||
| leucine-rich repeat | 81..104 | CDD:275378 | 9/22 (41%) | ||
| LRR_8 | 82..140 | CDD:290566 | 21/60 (35%) | ||
| LRR_4 | 82..120 | CDD:289563 | 14/38 (37%) | ||
| LRR 2 | 104..125 | 8/21 (38%) | |||
| LRR_4 | 105..144 | CDD:289563 | 15/41 (37%) | ||
| leucine-rich repeat | 105..129 | CDD:275378 | 8/24 (33%) | ||
| LRR 3 | 129..150 | 9/22 (41%) | |||
| leucine-rich repeat | 130..152 | CDD:275378 | 9/28 (32%) | ||
| leucine-rich repeat | 153..164 | CDD:275378 | 5/29 (17%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24373 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||