DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fili and vasnb

DIOPT Version :9

Sequence 1:NP_001369108.1 Gene:Fili / 5740472 FlyBaseID:FBgn0085397 Length:789 Species:Drosophila melanogaster
Sequence 2:NP_001104232.1 Gene:vasnb / 100004428 ZFINID:ZDB-GENE-110714-1 Length:668 Species:Danio rerio


Alignment Length:390 Identity:104/390 - (26%)
Similarity:148/390 - (37%) Gaps:84/390 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IPVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRALCVDAALEDVPIQLNPETKYINLTVNRI 85
            :||||.||...::..|.....||..|.|   :......|.......:|.::....|.:.:..|.|
Zfish     5 LPVLLPLLFYQLVPSPVLADTCPDNCTC---QVQDSIFCFSRKDTKMPSEVPTTVKNLYVFKNGI 66

  Fly    86 RTL-EFSLPFYMKLEILDLSQNIIETLGSKNFEYQSELRTLNLSRNLVSSLHKHAFKGLTNLLLL 149
            .:| :........||:||||||.:..|....||..|.|..|:||.|.:..:.|::|.||..|..|
Zfish    67 ESLSQEDFVHLGSLEMLDLSQNQLTELPDHVFEPLSSLNNLDLSANQIVHISKYSFAGLELLERL 131

  Fly   150 DLSFNRIETVHPTALSDLASLVELDLTNNNIVSLEDNCFKGMNTLEVLVFRNNRLLDVPASNLWH 214
            .|..|.||::||.|...|..|:||.|                        :.|:|..:||..:.|
Zfish   132 YLYSNLIESIHPAAFDGLHELLELKL------------------------QGNKLKILPALKMPH 172

  Fly   215 LHALKSLDMSLNLVEFVRNDSFEGLKELLALSVQGNVMSELDLSAFEGLISLKHLDLSDNNLTMV 279
               |..||:..|.:.....:..:..| |.:|.:.|..:|.|:........:|..||:|:|.||..
Zfish   173 ---LLLLDLRFNSIPSPGPNDLQTPK-LESLKLGGLGLSTLNEELLGSFKNLHELDISNNQLTAF 233

  Fly   280 PTQQLSKLSNLTYLNLGGNRFSQLPAVAFLNLFHLRELHLSRLDFLQRIDSRAFVDNTHLQTLHL 344
            |. .|.:...|..|.|.||....|....|..|..|.||.:|.|.                     
Zfish   234 PV-VLREAKGLVSLVLAGNPMGPLNWEDFEKLTELHELDISNLS--------------------- 276

  Fly   345 NNNPQLSDIPMRLFQGNPNILEVYMQSNSLQTLYSAQFPVDQLQKLYLGDNPLQCNCSLLWL--W 407
                         .||.|..|              ||. :..|::|.:.:||..|.|:|.|.  |
Zfish   277 -------------LQGLPETL--------------AQL-LPHLKRLTVAENPFNCLCNLAWFPSW 313

  Fly   408  407
            Zfish   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiliNP_001369108.1 leucine-rich repeat 75..97 CDD:275378 4/22 (18%)
leucine-rich repeat 98..121 CDD:275380 11/22 (50%)
LRR_8 120..180 CDD:404697 24/59 (41%)
leucine-rich repeat 122..145 CDD:275380 9/22 (41%)
leucine-rich repeat 146..169 CDD:275380 10/22 (45%)
LRR <161..>354 CDD:227223 44/192 (23%)
leucine-rich repeat 170..193 CDD:275380 4/22 (18%)
leucine-rich repeat 194..217 CDD:275380 5/22 (23%)
leucine-rich repeat 218..265 CDD:275380 10/46 (22%)
leucine-rich repeat 266..289 CDD:275380 9/22 (41%)
leucine-rich repeat 290..313 CDD:275380 8/22 (36%)
leucine-rich repeat 314..338 CDD:275380 5/23 (22%)
LRR_8 337..397 CDD:404697 9/59 (15%)
leucine-rich repeat 339..360 CDD:275380 0/20 (0%)
vasnbNP_001104232.1 LRR_RI <51..181 CDD:238064 47/156 (30%)
LRR_8 54..114 CDD:290566 21/59 (36%)
leucine-rich repeat 56..79 CDD:275380 4/22 (18%)
LRR_4 79..118 CDD:289563 17/38 (45%)
leucine-rich repeat 80..103 CDD:275380 11/22 (50%)
leucine-rich repeat 104..151 CDD:275380 19/46 (41%)
leucine-rich repeat 152..172 CDD:275380 8/43 (19%)
leucine-rich repeat 173..195 CDD:275380 4/21 (19%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
leucine-rich repeat 220..242 CDD:275380 9/22 (41%)
leucine-rich repeat 243..266 CDD:275380 8/22 (36%)
leucine-rich repeat 267..290 CDD:275380 11/71 (15%)
LRRCT 299..351 CDD:214507 7/15 (47%)
EGF_CA 417..449 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.