Sequence 1: | NP_001369108.1 | Gene: | Fili / 5740472 | FlyBaseID: | FBgn0085397 | Length: | 789 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001107114.1 | Gene: | lrrc3 / 100001372 | ZFINID: | ZDB-GENE-080327-13 | Length: | 266 | Species: | Danio rerio |
Alignment Length: | 261 | Identity: | 70/261 - (26%) |
---|---|---|---|
Similarity: | 113/261 - (43%) | Gaps: | 46/261 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 PVLLLLLLTLVILPPETTAFCPSKCQCLGGEANSRAL--CVDAALEDVPIQLNPETKYINLTVNR 84
Fly 85 IRTLE----FSLPFYMKLEILDLSQNIIETLGSKNFEYQSE-LRTLNLSRNLVSSLHKHAFKGLT 144
Fly 145 NLLLLDLSFNRIETVHPTALSDLASLVELDLTNNNIVSL---EDNCFKGMNTLEVLVFRNNRLLD 206
Fly 207 VPASNLWHLHALKSLDMSL-------------NLVEFVRN---DSFEGLKELLALSVQGNVMSEL 255
Fly 256 D 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fili | NP_001369108.1 | leucine-rich repeat | 75..97 | CDD:275378 | 6/25 (24%) |
leucine-rich repeat | 98..121 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 120..180 | CDD:404697 | 19/60 (32%) | ||
leucine-rich repeat | 122..145 | CDD:275380 | 11/22 (50%) | ||
leucine-rich repeat | 146..169 | CDD:275380 | 4/22 (18%) | ||
LRR | <161..>354 | CDD:227223 | 21/115 (18%) | ||
leucine-rich repeat | 170..193 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 194..217 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 218..265 | CDD:275380 | 9/55 (16%) | ||
leucine-rich repeat | 266..289 | CDD:275380 | |||
leucine-rich repeat | 290..313 | CDD:275380 | |||
leucine-rich repeat | 314..338 | CDD:275380 | |||
LRR_8 | 337..397 | CDD:404697 | |||
leucine-rich repeat | 339..360 | CDD:275380 | |||
lrrc3 | NP_001107114.1 | LRR_RI | <14..161 | CDD:238064 | 49/146 (34%) |
LRRNT | 38..72 | CDD:214470 | 13/36 (36%) | ||
leucine-rich repeat | 51..74 | CDD:275378 | 6/22 (27%) | ||
LRR 1 | 71..92 | 4/20 (20%) | |||
LRR_8 | 74..131 | CDD:290566 | 24/59 (41%) | ||
LRR_4 | 74..111 | CDD:289563 | 14/39 (36%) | ||
leucine-rich repeat | 75..95 | CDD:275378 | 4/19 (21%) | ||
LRR 2 | 95..116 | 10/23 (43%) | |||
leucine-rich repeat | 96..120 | CDD:275378 | 11/23 (48%) | ||
LRR 3 | 120..141 | 10/20 (50%) | |||
leucine-rich repeat | 121..144 | CDD:275378 | 11/22 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |