DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and rem2

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001116518.1 Gene:rem2 / 798285 ZFINID:ZDB-GENE-081110-1 Length:306 Species:Danio rerio


Alignment Length:181 Identity:53/181 - (29%)
Similarity:84/181 - (46%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 QENHQPVEFYRVEMLGSAGVGKQALL--------------SQFRTSDCINAYDGPECDDAEQNVS 276
            |:.|.|:   |:.:||..||||.:|.              |:.:.:|  ..|......|.|.:..
Zfish    69 QKYHGPL---RIVLLGQNGVGKSSLALCLAGLSDRSLSIDSETQAAD--EGYPRRVTVDDEDSSI 128

  Fly   277 IILNGTESELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILV 341
            ::.:..:.||..|           |.:..::|:|..|:.||.|..|:  ||...:.|.|.|.|||
Zfish   129 LVYDNWKQELSTL-----------QCEVCILVFSLTDRRSFHRIAQL--RLLLRESLPHTPIILV 180

  Fly   342 ANKIDLARSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIR 392
            .||.||.|||.:|.::....|..||..::|:||.::|..::||...:...|
Zfish   181 GNKSDLVRSREISTEEAHSSAMMFGCLYLELSVSLDHRTNDLLEAAVRAAR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 50/172 (29%)
rem2NP_001116518.1 P-loop_NTPase 75..305 CDD:304359 50/175 (29%)
Ras 76..231 CDD:278499 49/169 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.