DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and RRAD

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001122322.1 Gene:RRAD / 6236 HGNCID:10446 Length:308 Species:Homo sapiens


Alignment Length:360 Identity:99/360 - (27%)
Similarity:145/360 - (40%) Gaps:96/360 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 SKGGIINRGDSFRRRRSRSNSLAPSSPMHTRN------------GVGGLGGVAGGGSSLGLGCGY 211
            |:||    |.. |.||..|....|:.|:|.|:            ..|.|...|.|..:.|....:
Human    13 SRGG----GQE-RERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDW 72

  Fly   212 -NGGSSSNGFGNANAQENHQPVEFYRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNV 275
             .....|...|.:::.|:     .|:|.:||:.||||.||...|.     ...||||.:.|....
Human    73 PEDSEDSLSSGGSDSDES-----VYKVLLLGAPGVGKSALARIFG-----GVEDGPEAEAAGHTY 127

  Fly   276 --SIILNGTESEL-----------KFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRL 327
              ||:::|.|:.|           ::|.|:.     :...||:::|||..||.||.:|.::..:|
Human   128 DRSIVVDGEEASLMVYDIWEQDGGRWLPGHC-----MAMGDAYVIVYSVTDKGSFEKASELRVQL 187

  Fly   328 QDMDLLRHRPTILVANKIDLARSRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIR 392
            :........|.|||.||.||.|||.||..:|:..|..|..||||.|..::||...|..|.:.|||
Human   188 RRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIR 252

  Fly   393 LKKDQVQLQLNPKKSKDKDKNKFKENTNIETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVML 457
            |::|          ||:.:..:                      ..|.|...|            
Human   253 LRRD----------SKEANARR----------------------QAGTRRRES------------ 273

  Fly   458 ASMKARQMLTWILGKED------SKFKHCENLQVL 486
            ...||::.|..|:.:..      :|.|.|.:|.||
Human   274 LGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 63/173 (36%)
RRADNP_001122322.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..88 19/79 (24%)
RGK 92..308 CDD:206715 77/269 (29%)
RAS 92..252 CDD:214541 60/169 (36%)
Calmodulin-binding 278..297 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.