DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and CG14669

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001262281.1 Gene:CG14669 / 40652 FlyBaseID:FBgn0037326 Length:306 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:73/177 - (41%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RVEMLGSAGVGKQALLSQF------RT----------SDCINAYDGPECDDAEQNVSII------ 278
            :...||:.||||.::|.||      ||          .:|:      .||...:.:.::      
  Fly    96 KAAFLGATGVGKTSILQQFFYHDFPRTHQTTTHRKIYKNCL------VCDTCIRELMVLDVPPQK 154

  Fly   279 LNGTESELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHR--PTILV 341
            ....::..::..|:|..   |....|:::||...:.|:|...:.:  |.|.:|...||  ..|:|
  Fly   155 RFPADNFAEWNNGHPLG---LRTVHAYVLVYDMGNLETFQYCRSM--RDQILDSFSHRDFSIIVV 214

  Fly   342 ANKIDLARSRAVSAQDGKCVACTFGAK-----FIEVSVGINHNCDEL 383
            .||.|.......::|:.|.:: |...|     ::|.|...|:...::
  Fly   215 GNKFDNVTEAQANSQELKDIS-TLVRKHWRCGYVECSAQYNYKIGDV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 39/177 (22%)
CG14669NP_001262281.1 P-loop_NTPase 95..267 CDD:304359 39/177 (22%)
small_GTPase 96..265 CDD:197466 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453013
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.