DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and CG8519

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster


Alignment Length:230 Identity:62/230 - (26%)
Similarity:95/230 - (41%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 RVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFLTGNPESKDE-- 298
            ::.::|:..|||.||:.:|.|...|..|| .:.::..::.::: :|.....:.|...|:::||  
  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYD-HQTENRYKHEAMV-DGEPVLFEILDTCPKAEDEYP 79

  Fly   299 -----LEQADAFLVVYSCIDKESFT---RAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVSA 355
                 ::.||..|:|||..|::||.   |||.        ||....|..|.|||:|:...|.||.
  Fly    80 NAAELVQWADGLLLVYSITDRKSFNYIRRAKS--------DLQSDTPVQLCANKVDMVHLRQVSR 136

  Fly   356 QDGKCVACTFGAKFIEVSVG---------INHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKD 411
            .:|:.:|..|..||.|||..         .|..|.|:||                     ||.|.
  Fly   137 DEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLA---------------------SKRKS 180

  Fly   412 KNKFKENTNIETVETDNCLTDLKADDGGPRDANSP 446
            |....|          ..|...:....|..|:|.|
  Fly   181 KQSLLE----------RMLGGARPYSRGKSDSNLP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 52/178 (29%)
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 49/165 (30%)
P-loop_NTPase 17..173 CDD:304359 49/165 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452976
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.