DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and Rap1

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001189023.1 Gene:Rap1 / 38244 FlyBaseID:FBgn0004636 Length:184 Species:Drosophila melanogaster


Alignment Length:183 Identity:59/183 - (32%)
Similarity:91/183 - (49%) Gaps:17/183 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 YRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFL-TGNPES--- 295
            |::.:|||.||||.||..||.....:..|| |..:|:.:. .:.::|.:..|:.| |...|.   
  Fly     4 YKIVVLGSGGVGKSALTVQFVQCIFVEKYD-PTIEDSYRK-QVEVDGQQCMLEILDTAGTEQFTA 66

  Fly   296 -KD-ELEQADAFLVVYSCIDKESFT----RAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVS 354
             :| .::....|::|||...:.:|.    ..:||| |::|.|.:   |.:||.||.||...|.|.
  Fly    67 MRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQIL-RVKDTDDV---PMVLVGNKCDLEEERVVG 127

  Fly   355 AQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKS 407
            .:.||.:|..|...|:|.|.....|.:::....:.||. ||...:.|..||||
  Fly   128 KELGKNLATQFNCAFMETSAKAKVNVNDIFYDLVRQIN-KKSPEKKQKKPKKS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 53/170 (31%)
Rap1NP_001189023.1 Rap1 3..165 CDD:133375 51/166 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453001
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.