DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and Ric

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:241 Identity:61/241 - (25%)
Similarity:106/241 - (43%) Gaps:46/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 YRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILN--------GTESELKFLTG 291
            |::.:||..||||.|:..||.:...::.:| |..:|:.|..::|.|        .|..:::|.. 
  Fly    60 YKIVILGDGGVGKSAVTLQFVSHSFLDYHD-PTIEDSYQQQAVIDNEAALLDILDTAGQVEFTA- 122

  Fly   292 NPESKDE-LEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSRAVSA 355
               .:|: :...:.|::.||..|:.||..|.:....:..:.|....|.:|:|||:||...|.|:.
  Fly   123 ---MRDQYMRCGEGFIICYSVTDRHSFQEASEYRKLITRVRLSEDIPLVLIANKVDLESQRRVTT 184

  Fly   356 QDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFKENTN 420
            ::|:.:|..||..|.|.|..:.|..||.....:.:||.|:        ..|:...|.|..|.:| 
  Fly   185 EEGRNLANQFGCPFFETSAALRHYIDEAFYTLVREIRRKE--------MHKALGTDSNSEKIHT- 240

  Fly   421 IETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVMLASMKARQML 466
                              |.|     :.|::.||:.....:.|:.|
  Fly   241 ------------------GRR-----SRWWRIRSIFALVFRRRRNL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 49/169 (29%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 50/181 (28%)
small_GTPase 58..223 CDD:197466 48/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453014
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.