DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and Gem

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001100107.1 Gene:Gem / 297902 RGDID:1307386 Length:295 Species:Rattus norvegicus


Alignment Length:271 Identity:78/271 - (28%)
Similarity:116/271 - (42%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FYRVEMLGSAGVGKQALLSQF------RTSDC----INAYDGPECDDAEQNVSIILNGTESELKF 288
            :|||.::|..||||..|.:.|      ..|||    .:.|:.....|.|....|:|:..|::   
  Rat    74 YYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENK--- 135

  Fly   289 LTGNPESKDE--LEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSR 351
              |..|...:  ::..||:|:|||..|:.||.:|.::..:|:........|.|||.||.||.|.|
  Rat   136 --GENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCR 198

  Fly   352 AVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFK 416
            .||..:|:..|..|..||||.|..:.||..||..|.:.|:||::|          ||:|::.:..
  Rat   199 EVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRD----------SKEKNERRLA 253

  Fly   417 ENTNIETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVMLASMKARQMLTWILGKEDS------ 475
            .....|::               ||                   |||:....|:.|.:.      
  Rat   254 YQKRRESI---------------PR-------------------KARRFWGKIVAKNNKNMAFKL 284

  Fly   476 KFKHCENLQVL 486
            |.|.|.:|.||
  Rat   285 KSKSCHDLSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 60/172 (35%)
GemNP_001100107.1 RGK 75..295 CDD:206715 76/268 (28%)
small_GTPase 75..241 CDD:197466 59/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8910
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.