DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and Gem

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_034406.2 Gene:Gem / 14579 MGIID:99844 Length:295 Species:Mus musculus


Alignment Length:271 Identity:78/271 - (28%)
Similarity:116/271 - (42%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 FYRVEMLGSAGVGKQALLSQF------RTSDC----INAYDGPECDDAEQNVSIILNGTESELKF 288
            :|||.::|..||||..|.:.|      ..|||    .:.|:.....|.|....|:|:..|::   
Mouse    74 YYRVVLIGEQGVGKSTLANIFAGVHDSMDSDCEVLGEDTYERTLVVDGESATIILLDMWENK--- 135

  Fly   289 LTGNPESKDE--LEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSR 351
              |..|...:  ::..||:|:|||..|:.||.:|.::..:|:........|.|||.||.||.|.|
Mouse   136 --GENEWLHDHCMQVGDAYLIVYSITDRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCR 198

  Fly   352 AVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFK 416
            .||..:|:..|..|..||||.|..:.||..||..|.:.|:||::|          ||:|::.:..
Mouse   199 EVSVSEGRACAVVFDCKFIETSAAVQHNVKELFEGIVRQVRLRRD----------SKEKNERRLA 253

  Fly   417 ENTNIETVETDNCLTDLKADDGGPRDANSPAHWYKSRSVMLASMKARQMLTWILGKEDS------ 475
            .....|::               ||                   |||:....|:.|.:.      
Mouse   254 YQKRRESI---------------PR-------------------KARRFWGKIVAKNNKNMAFKL 284

  Fly   476 KFKHCENLQVL 486
            |.|.|.:|.||
Mouse   285 KSKSCHDLSVL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 60/172 (35%)
GemNP_034406.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..64
RGK 75..295 CDD:206715 76/268 (28%)
small_GTPase 75..241 CDD:197466 59/170 (35%)
Calmodulin-binding 265..284 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8675
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45775
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.