DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and Rheb

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:208 Identity:51/208 - (24%)
Similarity:87/208 - (41%) Gaps:37/208 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PVEFYRVEMLGSAGVGKQALLSQFRTSDCINAYDGPECDDAEQNVSIILNGTESELKFLTGNPES 295
            |.:...:.|:|...|||.:|..||.....:::|| |..::....:..: ...:..:|.:  :...
  Fly     2 PTKERHIAMMGYRSVGKSSLCIQFVEGQFVDSYD-PTIENTFTKIERV-KSQDYIVKLI--DTAG 62

  Fly   296 KDELE--------QADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLARSRA 352
            :||..        ....:::|||...::||...|.|..:|.|:...::.|.:||.|||||.:.|.
  Fly    63 QDEYSIFPVQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERT 127

  Fly   353 VSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQVQLQLNPKKSKDKDKNKFKE 417
            ||.::||.:|.::.|.|:|.|...|.:..::....|..|                         |
  Fly   128 VSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILI-------------------------E 167

  Fly   418 NTNIETVETDNCL 430
            |.|....|...||
  Fly   168 NENGNPQEKSGCL 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 44/168 (26%)
RhebNP_730950.2 RheB 5..182 CDD:206709 50/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453019
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.