DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rgk3 and rem1

DIOPT Version :9

Sequence 1:NP_001286670.1 Gene:Rgk3 / 5740446 FlyBaseID:FBgn0085426 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_012810748.1 Gene:rem1 / 100124825 XenbaseID:XB-GENE-493530 Length:280 Species:Xenopus tropicalis


Alignment Length:286 Identity:81/286 - (28%)
Similarity:128/286 - (44%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 RSRSNSLAPSSPMHTRNGVGGLGGVAGGGSSLGLGCGYNGGSSSNGFGNANAQENHQPVEFYRVE 238
            |.|:::..|.:..:.:.|...:..:.  ..|...|..:..||..:|..:.. .|.|     .||.
 Frog     9 RRRASTPLPCAHQNRQRGATPIRKLY--SPSKAAGSAHCSGSLDSGVSDGR-NEAH-----LRVV 65

  Fly   239 MLGSAGVGKQALLSQFRTS--------------DCINAYDGPE-----CDDAEQNVSIILNGTES 284
            :||..||||.:|::.||..              ||....||.|     .|..|:|:...:..::|
 Frog    66 LLGDPGVGKSSLVAIFRREQDREAAEQQLAEVFDCTLMVDGKETTLLVMDTDERNMKKAIESSDS 130

  Fly   285 ELKFLTGNPESKDELEQADAFLVVYSCIDKESFTRAKQILSRLQDMDLLRHRPTILVANKIDLAR 349
            .::.  ||           |:::|||..|:.||..|.::..:|:......:.|.|||.||.||.|
 Frog   131 PMRL--GN-----------AYIIVYSVTDRASFESASELRIQLRRTRQAENIPIILVGNKTDLVR 182

  Fly   350 SRAVSAQDGKCVACTFGAKFIEVSVGINHNCDELLAGTLTQIRLKKDQV------QLQLNPKKSK 408
            ||.||.::|:..|..|..||||.|..:.||..||..|.:.||||:::..      ::|...|:|.
 Frog   183 SREVSVEEGRACAVVFDCKFIETSAVLQHNVQELFEGMVRQIRLRREGADTAEGFRMQSQRKESL 247

  Fly   409 DKDKNKFKENTNIETVETDNCLTDLK 434
            .|...:|     ::.:.|.|..:.||
 Frog   248 TKRARRF-----LDRLVTRNSRSSLK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rgk3NP_001286670.1 P-loop_NTPase 235..>396 CDD:422963 61/179 (34%)
rem1XP_012810748.1 RGK 62..280 CDD:206715 70/225 (31%)
small_GTPase 63..227 CDD:197466 60/176 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.