DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34161 and CG18371

DIOPT Version :10

Sequence 1:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster
Sequence 2:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster


Alignment Length:93 Identity:48/93 - (51%)
Similarity:65/93 - (69%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QIFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQHKG 96
            |||||.||:||.||||..||.|:..|....:.||.|||.:|||:|.|||:|.::..:|:||.:.|
  Fly     7 QIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNIG 71

  Fly    97 SPRSVIEKAVFSENEPLPINNFKMFSIR 124
            ||||:||:|.|:..:.:..:||..||||
  Fly    72 SPRSIIERAEFTPTKEITSHNFSRFSIR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34161NP_001097143.1 Acylphosphatase 36..123 CDD:425830 41/86 (48%)
CG18371NP_610923.1 Acylphosphatase 13..98 CDD:425830 40/84 (48%)

Return to query results.
Submit another query.