DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34298 and ADAM17

DIOPT Version :10

Sequence 1:NP_001097976.1 Gene:CG34298 / 5740436 FlyBaseID:FBgn0085327 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_003174.3 Gene:ADAM17 / 6868 HGNCID:195 Length:824 Species:Homo sapiens


Alignment Length:120 Identity:30/120 - (25%)
Similarity:46/120 - (38%) Gaps:37/120 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 GRQVDEDKSPRDFLHLPDNNWVV---LPSFKYQFEHLTPYLSCRQSKYMRCRFQKFLDNVPSSYV 92
            |..|.|..| |...|:.|::.::   ....:|..|.|..:::..:.|.|                
Human   117 GHVVGEPDS-RVLAHIRDDDVIIRINTDGAEYNIEPLWRFVNDTKDKRM---------------- 164

  Fly    93 TISLYGS----NVSNMPKPRRKSLNGQFYGVDN-KLAPVPAVADPRSPP----HR 138
              .:|.|    |||.:..|:   :.| :..||| :|.|...|  .|.||    ||
Human   165 --LVYKSEDIKNVSRLQSPK---VCG-YLKVDNEELLPKGLV--DREPPEELVHR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34298NP_001097976.1 None
ADAM17NP_003174.3 Pep_M12B_propep 52..167 CDD:460254 12/68 (18%)
Cysteine switch. /evidence=ECO:0000250 182..189 1/10 (10%)
ZnMc_TACE_like 223..477 CDD:239798
DISIN 484..560 CDD:214490
ADAM17_MPD 581..642 CDD:465239
Crambin-like 603..671
SH3-binding. /evidence=ECO:0000255 731..738
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 732..824
SH3-binding. /evidence=ECO:0000255 741..748
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.