DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34298 and Tace

DIOPT Version :10

Sequence 1:NP_001097976.1 Gene:CG34298 / 5740436 FlyBaseID:FBgn0085327 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_733334.1 Gene:Tace / 43558 FlyBaseID:FBgn0039734 Length:732 Species:Drosophila melanogaster


Alignment Length:146 Identity:28/146 - (19%)
Similarity:54/146 - (36%) Gaps:22/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FTSWPVKFDINQLIKEF------------QPEEKGRQVDEDKSPRDFLHLPDNNWVVLPSFKYQF 61
            |.::.|..|.|:.:...            :.|...|...||.:....:|||:..:.:.||:::..
  Fly    90 FRAYAVDADGNETVVHMDHDSFYSGRVFGELESSVRAHIEDGTMTMSIHLPEETYHIEPSWRHLP 154

  Fly    62 EHLTPYLSCRQSKYMRCRFQKFLDNVPSS--YVTISL------YGSNVSNMPKPRRKSLNGQF-Y 117
            |.....:...::..::.. :......|.:  |:...|      :|..:.|....|.|..:.|: |
  Fly   155 EAKKDTMVAYKASDVKVH-KNEAGATPKTCGYIKEGLELEDKEHGDTLDNELHTREKRQSDQYEY 218

  Fly   118 GVDNKLAPVPAVADPR 133
            .......|:..|||.|
  Fly   219 TPTKTRCPLLLVADYR 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34298NP_001097976.1 None
TaceNP_733334.1 Pep_M12B_propep 44..164 CDD:460254 14/73 (19%)
ZnMc_TACE_like 223..470 CDD:239798 5/12 (42%)
Disintegrin 477..552 CDD:459709
ADAM17_MPD 576..633 CDD:271205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.