DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34298 and ADAM10

DIOPT Version :10

Sequence 1:NP_001097976.1 Gene:CG34298 / 5740436 FlyBaseID:FBgn0085327 Length:139 Species:Drosophila melanogaster
Sequence 2:NP_001101.1 Gene:ADAM10 / 102 HGNCID:188 Length:748 Species:Homo sapiens


Alignment Length:37 Identity:12/37 - (32%)
Similarity:19/37 - (51%) Gaps:5/37 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 CRQSKYMRCRFQKFLDNVPSSYVTISLYGSNVSNMPK 106
            |.:||......:|.|:   :..:|:..|||:|.  ||
Human   344 CEKSKLYSDGKKKSLN---TGIITVQNYGSHVP--PK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34298NP_001097976.1 None
ADAM10NP_001101.1 Pep_M12B_propep 46..156 CDD:460254
Cysteine switch. /evidence=ECO:0000250 171..178
ZnMc_TACE_like 220..459 CDD:239798 12/37 (32%)
DISIN 466..545 CDD:214490
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 704..748
SH3-binding. /evidence=ECO:0000255 708..715
SH3-binding. /evidence=ECO:0000255 722..728
Interaction with AP2A1, AP2A2 and AP2M1. /evidence=ECO:0000250|UniProtKB:O35598 734..748
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.