| Sequence 1: | NP_001097976.1 | Gene: | CG34298 / 5740436 | FlyBaseID: | FBgn0085327 | Length: | 139 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001101.1 | Gene: | ADAM10 / 102 | HGNCID: | 188 | Length: | 748 | Species: | Homo sapiens |
| Alignment Length: | 37 | Identity: | 12/37 - (32%) |
|---|---|---|---|
| Similarity: | 19/37 - (51%) | Gaps: | 5/37 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 70 CRQSKYMRCRFQKFLDNVPSSYVTISLYGSNVSNMPK 106 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34298 | NP_001097976.1 | None | |||
| ADAM10 | NP_001101.1 | Pep_M12B_propep | 46..156 | CDD:460254 | |
| Cysteine switch. /evidence=ECO:0000250 | 171..178 | ||||
| ZnMc_TACE_like | 220..459 | CDD:239798 | 12/37 (32%) | ||
| DISIN | 466..545 | CDD:214490 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 704..748 | ||||
| SH3-binding. /evidence=ECO:0000255 | 708..715 | ||||
| SH3-binding. /evidence=ECO:0000255 | 722..728 | ||||
| Interaction with AP2A1, AP2A2 and AP2M1. /evidence=ECO:0000250|UniProtKB:O35598 | 734..748 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||