DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34184 and CG34429

DIOPT Version :10

Sequence 1:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001097598.1 Gene:CG34429 / 5740606 FlyBaseID:FBgn0085458 Length:249 Species:Drosophila melanogaster


Alignment Length:181 Identity:56/181 - (30%)
Similarity:81/181 - (44%) Gaps:19/181 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LKNRNVFLSYNYEFNYYQPEHVYKYPPILMGDNWE--DSYLTYNTTGGDDSSSSRSFRSVDDNSS 103
            ||..:|...|..:..||.|   |....:...|..|  :|.|..|.|..|........:...|...
  Fly    67 LKVESVITGYVLKAQYYLP---YSAKQLRTKDVHEISESRLLQNATIFDKVMQMSEQKLGFDPDI 128

  Fly   104 TQKRTLPIMS-RTNFY-----IMLKDKLERSGYPAESCLLRLICETNSSTLGEVNGLLGSIVHIL 162
            .|:....:.| |.:.|     :.::.||.     ...|:|:.|||:.::...:.|||||.::|||
  Fly   129 LQEDLQALGSYRWSVYEAFTALAIRMKLN-----GRVCVLKSICESAAAPFDDRNGLLGEVLHIL 188

  Fly   163 FTPSSSND---ENLDKDYYQAEWDGLRHGDCSFYASQCEENVLDLISRPLH 210
            .|||||.|   |:.|.||.|||..|...|||.....:|.:::|:..|...|
  Fly   189 LTPSSSVDPLSEHSDNDYLQAERLGAAGGDCDQVYPRCPKSLLEHFSDVHH 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34184NP_001097310.1 DM4_12 114..197 CDD:462285 34/90 (38%)
CG34429NP_001097598.1 DM4_12 137..233 CDD:214785 37/100 (37%)

Return to query results.
Submit another query.