DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34184 and CG17780

DIOPT Version :10

Sequence 1:NP_001097310.1 Gene:CG34184 / 5740423 FlyBaseID:FBgn0085213 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_732995.1 Gene:CG17780 / 42914 FlyBaseID:FBgn0039197 Length:345 Species:Drosophila melanogaster


Alignment Length:216 Identity:49/216 - (22%)
Similarity:81/216 - (37%) Gaps:62/216 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVFLKLIF---------VESTLLYQTNSEFGIFMAISVPLTLKNRNVFLSYNYEFNYYQPEHVYK 64
            |..|||||         :|:|.::     .|||..|.        |.:::...:|......:|.|
  Fly   180 FKMLKLIFRRAKRYLDIIETTRIF-----VGIFQVIV--------NTYINSPLKFRVNAKNNVIK 231

  Fly    65 YPPILMGDNWEDSYLTYNTTGGDDSSSSRSFRSVDDNSS--TQKRTLPIMSRTNFYIMLKDKLER 127
            .|.:     |...|               .||:   |:.  .::...|.  |.:.|.:|.:.::|
  Fly   232 SPIV-----WAHGY---------------GFRA---NTPVLVKRENRPF--RRDTYELLHELIDR 271

  Fly   128 SGYPAESCLLRLICETNSSTLGEVNGLLGSIVHILFTPSSSNDENLDKDYYQAEWDGLRHGDC-S 191
            ||....:|:|:..|...:...|:  |.|..::..:||        || ::.:.....||..:| .
  Fly   272 SGLDGRACVLKAYCTALAGDHGQ--GFLFKLLKYVFT--------LD-EHDKRHMPHLREENCEQ 325

  Fly   192 FYASQCEENVLDLISRPLHDV 212
            ...|.|..: .|.||....||
  Fly   326 IMHSHCPLS-FDSISPYTDDV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34184NP_001097310.1 DM4_12 114..197 CDD:462285 20/83 (24%)
CG17780NP_732995.1 DM4_12 136..>188 CDD:462285 5/7 (71%)
DM4_12 253..338 CDD:214785 23/98 (23%)

Return to query results.
Submit another query.