DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34242 and SMIM20

DIOPT Version :10

Sequence 1:NP_001097595.1 Gene:CG34242 / 5740417 FlyBaseID:FBgn0085271 Length:58 Species:Drosophila melanogaster
Sequence 2:NP_001138904.1 Gene:SMIM20 / 389203 HGNCID:37260 Length:67 Species:Homo sapiens


Alignment Length:47 Identity:15/47 - (31%)
Similarity:26/47 - (55%) Gaps:6/47 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSK--IKRDELQ 53
            |.||:|.|    |...||:...|::..|:||..|..::  |.::::|
Human    11 FGGFISLI----GAAFYPIYFRPLMRLEEYKKEQAINRAGIVQEDVQ 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34242NP_001097595.1 DUF4538 4..56 CDD:405708 15/47 (32%)
SMIM20NP_001138904.1 DUF4538 2..57 CDD:405708 15/47 (32%)

Return to query results.
Submit another query.