DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34242 and smim20

DIOPT Version :10

Sequence 1:NP_001097595.1 Gene:CG34242 / 5740417 FlyBaseID:FBgn0085271 Length:58 Species:Drosophila melanogaster
Sequence 2:NP_001289553.1 Gene:smim20 / 100330558 ZFINID:ZDB-GENE-131002-2 Length:68 Species:Danio rerio


Alignment Length:49 Identity:14/49 - (28%)
Similarity:28/49 - (57%) Gaps:6/49 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSK--IKRDELQHI 55
            |.|||:    ||....||:...|:.::|.||.:|:.::  :.:.::|.:
Zfish    11 FGGFVA----AVAAAFYPIFFHPLTHSEDYKQVQKVNRAGVNQADIQPV 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34242NP_001097595.1 DUF4538 4..56 CDD:405708 14/49 (29%)
smim20NP_001289553.1 DUF4538 <23..57 CDD:405708 8/33 (24%)

Return to query results.
Submit another query.