DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snoo and ski

DIOPT Version :10

Sequence 1:NP_609164.3 Gene:Snoo / 5740414 FlyBaseID:FBgn0085450 Length:1223 Species:Drosophila melanogaster
Sequence 2:XP_004916211.1 Gene:ski / 100486949 XenbaseID:XB-GENE-494028 Length:719 Species:Xenopus tropicalis


Alignment Length:68 Identity:13/68 - (19%)
Similarity:25/68 - (36%) Gaps:20/68 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1436 QYCVKLHRTGGISLDAQNKEGFTALH------------------ISAQTGHEAIFGYLLSHGANA 1482
            |..:.|....|:......:||...||                  :|..:|::  |||::....::
 Frog     4 QDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYD--FGYMVKLLTDS 66

  Fly  1483 TIP 1485
            .:|
 Frog    67 RLP 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SnooNP_609164.3 DHD_Ski_Sno 116..206 CDD:410782
c-SKI_SMAD_bind 226..317 CDD:198114
AF-4 637..>789 CDD:461550
skiXP_004916211.1 DHD_Ski 74..175 CDD:410786
c-SKI_SMAD_bind 201..299 CDD:198114
SMC_prok_B 529..>700 CDD:274008
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.