DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and AT3G56510

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001030873.1 Gene:AT3G56510 / 824818 AraportID:AT3G56510 Length:257 Species:Arabidopsis thaliana


Alignment Length:215 Identity:62/215 - (28%)
Similarity:96/215 - (44%) Gaps:47/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IETSDKPQPEDG---ESANGEANPSDEGDEMELASFKAACSSSDPAKKIK------------KGI 71
            :::.:..:..||   |..:.|...|.:.|..:              ||:|            :|:
plant     1 MQSEESHELTDGISEEKESKETMKSQKADRKK--------------KKLKEKLLKEASKADNRGV 51

  Fly    72 IYISNIPKHMTLTHLREILGEYGGIGRAFLRSQSSK---HHNIL-------FAEGWVEFKSKHVA 126
            .|:|.||.||....||.||.:||.:||.:|..:.|:   |....       |:||||||..|.||
plant    52 CYLSRIPPHMDHVRLRHILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVA 116

  Fly   127 KQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKEAK 191
            |::..:||.:||..:..|..||.:|:::||.:|||..|.|.:.:......|. |..:...||..|
plant   117 KRVADMLNGEQIGGKKKSSVYYDIWNIKYLTKFKWDDLTEEIAYKSAIREQK-LNMVLSAAKREK 180

  Fly   192 -------EVKKAMKVLADRL 204
                   |..:||..:..|:
plant   181 DFYLSKIEKSRAMTEIDARM 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 36/91 (40%)
AT3G56510NP_001030873.1 RRM_ABT1_like 50..146 CDD:409707 37/95 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
OMA 1 1.010 - - QHG56381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm3465
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.