DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and CG40813

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001104071.2 Gene:CG40813 / 5740386 FlyBaseID:FBgn0085521 Length:213 Species:Drosophila melanogaster


Alignment Length:213 Identity:211/213 - (99%)
Similarity:211/213 - (99%) Gaps:0/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEIKRKSKPKRKPTRMEVEEIETSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSSDPAK 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKEIKRKSKPKRKPTRMEVEEIETSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSSDPAK 65

  Fly    66 KIKKGIIYISNIPKHMTLTHLREILGEYGGIGRAFLRSQSSKHHNILFAEGWVEFKSKHVAKQLV 130
            |||||||||||||||||||.|||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 KIKKGIIYISNIPKHMTLTRLREILGEYGGIGRAFLRSQSSKHHNILFAEGWVEFKSKHVAKQLV 130

  Fly   131 LLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKEAKEVKK 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 LLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKEAKEVKK 195

  Fly   196 AMKVLADRLLELALDSNI 213
            ||||||||||||.|||||
  Fly   196 AMKVLADRLLELPLDSNI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 80/81 (99%)
CG40813NP_001104071.2 RRM_ABT1_like 75..157 CDD:240709 80/81 (99%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136005
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12311
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1640
87.990

Return to query results.
Submit another query.