DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and abt1

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001018383.1 Gene:abt1 / 553568 ZFINID:ZDB-GENE-050522-127 Length:305 Species:Danio rerio


Alignment Length:230 Identity:69/230 - (30%)
Similarity:107/230 - (46%) Gaps:60/230 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPTRMEVEEIETSDKPQPE--------DGESANGEANPSDEGDEMELASFKAACSSSDP-AKKIK 68
            ||.:.|.|:.:::::.:.|        |||:.:.|....|:.||.:        .|..| .||..
Zfish    28 KPEKDEEEKADSAEEDEQEMNSEEDINDGEAFHMEIEDDDDDDEED--------ESDKPKGKKCV 84

  Fly    69 KGIIYISNIPKHMTLTHLREILGEYGGIGRAFLRSQ--------------SSKHHNILFAEGWVE 119
            .||:|:.:||..|...|:|.:|..||.|||.||:.:              ||.     |.|||||
Zfish    85 PGIVYLGHIPPRMRPKHMRNLLSAYGEIGRIFLQPEDRCVKRKKKKAGCKSSS-----FTEGWVE 144

  Fly   120 FKSKHVAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQ------------ 172
            |:.|.|||::...|:|..::.|..|.|...|||::||.||:|..|:|.:.:.|            
Zfish   145 FRDKRVAKRVAASLHNTPMANRKRSRFSSDLWSIKYLHRFQWCHLSERLAYEQTVYHQRMRTEIS 209

  Fly   173 ------------VTNSQNHLEFLKKKAKEAKEVKK 195
                        |..||:..:..||:||:.:.|::
Zfish   210 QAKKETNFYLASVEKSQSLEKLRKKRAKKGEVVEE 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 35/95 (37%)
abt1NP_001018383.1 RRM_ABT1_like 86..182 CDD:240709 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580309
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4108
OMA 1 1.010 - - QHG56381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.890

Return to query results.
Submit another query.