DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and CG10993

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster


Alignment Length:219 Identity:164/219 - (74%)
Similarity:177/219 - (80%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEIKRKSKPKRKPTRMEVEEIET----SDKPQPEDGESANGEANPSDEGDEMELASFKAACSSS 61
            |||||:|||||||||||||||.|.    |.|.||::|||.||||:.||:|||||||:||||.   
  Fly     1 MKEIKKKSKPKRKPTRMEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAAS--- 62

  Fly    62 DPAKKIKKGIIYISNIPKHMTLTHLREILGEYGGIGRAFLRSQ--SSKHHNILFAEGWVEFKSKH 124
                  |||:|||||:|||||||.|||||||||.|||||||||  |.|.||.||||||||||||.
  Fly    63 ------KKGVIYISNLPKHMTLTRLREILGEYGAIGRAFLRSQKLSRKPHNFLFAEGWVEFKSKR 121

  Fly   125 VAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKE 189
            ||||:|.|||.|||||...||||||||.||||||||||||.||||.|.||||||||:||.||||:
  Fly   122 VAKQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLNKKAKK 186

  Fly   190 AKEVKKAMKVLADRLLELALDSNI 213
            ||:||||.|.||||||||.|.|:|
  Fly   187 AKKVKKAKKALADRLLELVLASSI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 67/83 (81%)
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:240709 71/88 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Homologene 1 1.000 - - H136005
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
109.920

Return to query results.
Submit another query.