DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and CG10993

DIOPT Version :10

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_572923.1 Gene:CG10993 / 32344 FlyBaseID:FBgn0030524 Length:210 Species:Drosophila melanogaster


Alignment Length:219 Identity:164/219 - (74%)
Similarity:177/219 - (80%) Gaps:15/219 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEIKRKSKPKRKPTRMEVEEIET----SDKPQPEDGESANGEANPSDEGDEMELASFKAACSSS 61
            |||||:|||||||||||||||.|.    |.|.||::|||.||||:.||:|||||||:||||.   
  Fly     1 MKEIKKKSKPKRKPTRMEVEESEPEMPFSYKTQPDEGESVNGEAHTSDDGDEMELATFKAAS--- 62

  Fly    62 DPAKKIKKGIIYISNIPKHMTLTHLREILGEYGGIGRAFLRSQ--SSKHHNILFAEGWVEFKSKH 124
                  |||:|||||:|||||||.|||||||||.|||||||||  |.|.||.||||||||||||.
  Fly    63 ------KKGVIYISNLPKHMTLTRLREILGEYGAIGRAFLRSQKLSRKPHNFLFAEGWVEFKSKR 121

  Fly   125 VAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKE 189
            ||||:|.|||.|||||...||||||||.||||||||||||.||||.|.||||||||:||.||||:
  Fly   122 VAKQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARLNELMNIVPVTNSQNHLKFLNKKAKK 186

  Fly   190 AKEVKKAMKVLADRLLELALDSNI 213
            ||:||||.|.||||||||.|.|:|
  Fly   187 AKKVKKAKKALADRLLELVLASSI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:409707 67/83 (81%)
CG10993NP_572923.1 RRM_ABT1_like 65..154 CDD:409707 71/88 (81%)

Return to query results.
Submit another query.