DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and CG32708

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_727306.1 Gene:CG32708 / 318161 FlyBaseID:FBgn0052708 Length:239 Species:Drosophila melanogaster


Alignment Length:236 Identity:136/236 - (57%)
Similarity:159/236 - (67%) Gaps:34/236 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKEIKRKSKPKRKPTRMEVEEIE----TSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSS 61
            ||.||.|||||||||.|||||.|    .||:|||.:||:|||||||||:.|:|:||:|||..|||
  Fly     1 MKNIKNKSKPKRKPTPMEVEEAELDEVRSDEPQPGEGETANGEANPSDDDDDMDLANFKATSSSS 65

  Fly    62 DPAKKIKKGIIYISNIPKHMTLTHLREILGEYGGIGRAFL----------RSQSSKHHNILFAEG 116
            .||||.|.||||||||||||.:|.|||||||||.|||.:|          :....|.:||.|.||
  Fly    66 APAKKRKMGIIYISNIPKHMNVTRLREILGEYGAIGRVYLQPEKLSSAKAKKNKRKRYNIHFTEG 130

  Fly   117 WVEFKSKHVAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNS----- 176
            |||||||.||||:|.||||||||.|..|.||.|||||:|||||||..|.|.||:.|..:.     
  Fly   131 WVEFKSKRVAKQIVPLLNNKQISGRKTSQFYDSLWSMKYLPRFKWVHLTERMNYEQAVHKQRLHT 195

  Fly   177 ------------QNHL---EFLKKKAKEAKEVKKAMKVLAD 202
                        ||:|   ||::|:||:||..:||:...:|
  Fly   196 EVSQARKETTFFQNNLDKSEFIRKQAKKAKNAEKALAAKSD 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 57/91 (63%)
CG32708NP_727306.1 RRM_ABT1_like 74..171 CDD:240709 62/96 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448411
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Homologene 1 1.000 - - H136005
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
109.920

Return to query results.
Submit another query.