DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and CG32706

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_727307.1 Gene:CG32706 / 318160 FlyBaseID:FBgn0052706 Length:230 Species:Drosophila melanogaster


Alignment Length:218 Identity:89/218 - (40%)
Similarity:128/218 - (58%) Gaps:29/218 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MEVEEIE----TSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSSDPAKKIKK----GIIY 73
            |:|||.:    .|.|||.::||||||.||||:: |:.|||:|||..:|..|.||.:|    |:|.
  Fly     1 MKVEETKLGEVRSGKPQTKEGESANGVANPSND-DKKELANFKATFNSWAPEKKREKMHKVGVIL 64

  Fly    74 ISNIPKHMTLTHLREILGEYGGIGRAFLRSQ--SSKHHNILFAEGWVEFKSKHVAKQLVLLLNNK 136
            ||||||.|....|:||:..:..:||.:::.:  ||........:|||||.||..||::.|.||||
  Fly    65 ISNIPKDMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAKKIALELNNK 129

  Fly   137 QISTRNNSPFYYSLWSMEYLPRFKWARLAELMNF------VQVTN----------SQNHLEFLKK 185
            .|:...:|.|...||.|::||||||..|.:.|::      |:|.:          ..:.:|:.||
  Fly   130 PITDGKSSRFRGLLWKMKFLPRFKWYYLTDRMDYELAVCKVRVWSQARKRATFLYDPDQMEYFKK 194

  Fly   186 KAKEAKEVKKAMKVLADRLLELA 208
            :.|:.|:||||  .:|.|..|:|
  Fly   195 QVKKMKKVKKA--EMATRNAEMA 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 33/83 (40%)
CG32706NP_727307.1 RRM_ABT1_like 61..150 CDD:240709 36/88 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448410
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Homologene 1 1.000 - - H136005
Inparanoid 1 1.050 134 1.000 Inparanoid score I1841
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm26593
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12311
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1640
98.890

Return to query results.
Submit another query.