DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and Abt1

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_038952.1 Gene:Abt1 / 30946 MGIID:1353636 Length:269 Species:Mus musculus


Alignment Length:180 Identity:59/180 - (32%)
Similarity:86/180 - (47%) Gaps:36/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 ESANGEANPSDEGDEMELASFKAACSSSD-PAKKIKKGIIYISNIPKHMTLTHLREILGEYGGIG 97
            |.||.||....|..|      ..|||||. ..||:..||:|:.::|......|:|.:|..||.:|
Mouse    17 EEANAEAAEDQEEPE------DTACSSSSKKKKKVVPGIVYLGHVPPRFRPLHVRNLLSAYGEVG 75

  Fly    98 RAFLRSQS---------------------SKHHNILFAEGWVEFKSKHVAKQLVLLLNNKQISTR 141
            |.|.:::.                     ||.    :.||||||:.|.|||::...|:|..:..|
Mouse    76 RVFFQAEDHFVKRKKKAAAAAGGKKGAKYSKD----YTEGWVEFRDKRVAKRVAASLHNTPMGAR 136

  Fly   142 NNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKEAK 191
            ..|||.|.||:::||.||.|:.|:|.:.|.:....|.    |:.:..:||
Mouse   137 KRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQR----LRAEVAQAK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 31/102 (30%)
Abt1NP_038952.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 12/28 (43%)
RRM_ABT1_like 48..152 CDD:240709 34/107 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 139 1.000 Inparanoid score I4495
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm42998
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.890

Return to query results.
Submit another query.