DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and Abt1

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001020845.1 Gene:Abt1 / 306960 RGDID:1310785 Length:268 Species:Rattus norvegicus


Alignment Length:214 Identity:61/214 - (28%)
Similarity:103/214 - (48%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MEVEEIETSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSSDPAKKIKKGIIYISNIPKHM 81
            ::|.::....|...|:.:..|.||     .:|:|.|. :|:|:.|  .||:..||:|:.::|...
  Rat     2 VKVGKLVEEQKAAMEEEKEVNAEA-----AEELEEAE-EASCNGS--KKKVVPGIVYLGHVPPRF 58

  Fly    82 TLTHLREILGEYGGIGRAFLRSQS---------------------SKHHNILFAEGWVEFKSKHV 125
            ...|:|.:|..||.:||.|.:::.                     ||.    :.||||||:.|.:
  Rat    59 RPLHVRNLLSVYGEVGRVFFQAEDPFVRRKKKAAAAAGGKKGAKYSKD----YTEGWVEFRDKRI 119

  Fly   126 AKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNFVQVTNSQNHLEFLKKKAKEA 190
            ||::...|:|..:..|..|||.|.||:::||.||.|:.|:|.:.|.:....|.    |:.:..:|
  Rat   120 AKRVAASLHNTPMGARKRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQR----LRAEVAQA 180

  Fly   191 K--------EVKKAMKVLA 201
            |        .|::..:.||
  Rat   181 KRETDFYLRNVEQGQRFLA 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 30/102 (29%)
Abt1NP_001020845.1 RRM_ABT1_like 47..151 CDD:240709 33/107 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..242 61/214 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340511
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 130 1.000 Inparanoid score I4546
OMA 1 1.010 - - QHG56381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm45062
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.