DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and F57B10.8

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_491887.1 Gene:F57B10.8 / 172368 WormBaseID:WBGene00019005 Length:268 Species:Caenorhabditis elegans


Alignment Length:262 Identity:78/262 - (29%)
Similarity:120/262 - (45%) Gaps:61/262 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KEIKRKSKPKRKPT---RMEVEEIETSDKPQPEDGESANGE---ANPSD--------EGDEMELA 52
            |:|.|||  .:||.   .|::||.:...:|:.|..|:.|.|   .|..|        |.||||  
 Worm     9 KKIVRKS--IKKPVVEEDMKMEEEKEMLEPKEESIETDNNEDEAGNLDDSEIKTEESEDDEME-- 69

  Fly    53 SFKAACSSSDPAKKIKK-GIIYISNIPKHMTLTHLREILGEY--GGIGRAFL-RSQSSKHHNILF 113
                  :..||.:|.|| |:::.|.||....:..:||...:.  |.:||.|| |::.||:...|:
 Worm    70 ------TFEDPEQKQKKTGVVFFSTIPPKYNVVRMREYFEKRCPGQVGRIFLARNKHSKNPQYLY 128

  Fly   114 AEGWVEFKSKHVAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARLAELMNF-------- 170
            :|||:|.|.|.:||.:...::|..|..:|..|....||::.||..|||..|.|.:.:        
 Worm   129 SEGWMELKKKKIAKAIAEQIDNTPIGGKNKDPVSSMLWNIRYLSGFKWVHLMEQLQYEKEVEKRR 193

  Fly   171 --VQVTNSQN---HLEFLKKKAK-----EAK---------------EVKKAMKVLADRLLELALD 210
              |:|..::.   |.|...:|.|     |||               :.||.:||..:|...:..:
 Worm   194 MNVEVAQARRIAAHFEEQIEKGKHLRKLEAKVTASGGKWDKFQRDVQQKKVVKVKKERSKHVNTE 258

  Fly   211 SN 212
            |:
 Worm   259 SS 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 29/84 (35%)
F57B10.8NP_491887.1 RRM_SF 82..172 CDD:302621 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3152
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I3295
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm14709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12311
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R417
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.