DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG41562 and abt1

DIOPT Version :9

Sequence 1:NP_001104090.1 Gene:CG41562 / 5740411 FlyBaseID:FBgn0085693 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001234912.2 Gene:abt1 / 100145601 XenbaseID:XB-GENE-5916363 Length:276 Species:Xenopus tropicalis


Alignment Length:197 Identity:57/197 - (28%)
Similarity:97/197 - (49%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ETSDKPQPEDGESANGEANPSDEGDEMELASFKAACSSSDPAKKIKKGIIYISNIPKHMTLTHLR 87
            |.:::.:|    ...||.:..:|..|.|.|..:.  ..|...|::..||||:.:||..:...|:|
 Frog     6 EAAEEQEP----MGQGEESMEEEEPERETAEDEE--KGSLGGKRVVPGIIYLGHIPPRLRPRHIR 64

  Fly    88 EILGEYGGIGRAFLRSQ-------------SSKHHNILFAEGWVEFKSKHVAKQLVLLLNNKQIS 139
            .:|..:|.:||.||:::             ::|.    |.||||||:.|.|||.:...||:..:.
 Frog    65 NMLSGHGEVGRIFLQAEERFVRKKKKKAGTNAKD----FTEGWVEFRDKRVAKLVAASLNSAPMG 125

  Fly   140 TRNNSPFYYSLWSMEYLPRFKWARLAELMNF----------VQVTNSQNHLEFLKKKAKEAKEVK 194
            ||..:.|:..||:|:||.||||:.|:|.:..          .:|:.::....|..:..:.:|:..
 Frog   126 TRKKNRFHDDLWNMKYLHRFKWSHLSERLALERQVRQQRMRAEVSQAKRETNFYLQNVERSKKFS 190

  Fly   195 KA 196
            ||
 Frog   191 KA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG41562NP_001104090.1 RRM_ABT1_like 75..157 CDD:240709 31/94 (33%)
abt1NP_001234912.2 RRM_ABT1_like 47..143 CDD:240709 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5103
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002458
OrthoInspector 1 1.000 - - otm48122
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1640
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.