DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and AT4G35820

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_195307.1 Gene:AT4G35820 / 829736 AraportID:AT4G35820 Length:272 Species:Arabidopsis thaliana


Alignment Length:188 Identity:46/188 - (24%)
Similarity:85/188 - (45%) Gaps:36/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 EEISRDPLIWLYHDVI--------YDSEIAQLTNVTREEMILGTTTNYTT------PDRVNRLFH 358
            |.|:::|..::||:.:        .:.|...|.::.:..|......|..|      ..|.:....
plant    89 EVITKEPRAFVYHNFLALFFKICKTNEECDHLISLAKPSMARSKVRNALTGLGEESSSRTSSGTF 153

  Fly   359 IKVTDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPELTEEGDR 423
            |:...|   |:.|.:..|:::.:.:...|..||..|||.:|..|:.|.|..            .|
plant   154 IRSGHD---KIVKEIEKRISEFTFIPQENGETLQVINYEVGQKFEPHFDGF------------QR 203

  Fly   424 LMTFLFYMTDVPVGGTTIFPGAQ-------LAIQPKKGSALFWYNLHNNGDPNLLTRH 474
            :.|.|.|::||..||.|:||.|:       ::::||||.||.::::..:|..:..::|
plant   204 IATVLMYLSDVDKGGETVFPEAKGIKSKKGVSVRPKKGDALLFWSMRPDGSRDPSSKH 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 41/164 (25%)
AT4G35820NP_195307.1 UBN2_2 3..77 CDD:290927
P4Hc 115..262 CDD:214780 41/162 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1106
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.