DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and AT4G33910

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_567941.1 Gene:AT4G33910 / 829535 AraportID:AT4G33910 Length:288 Species:Arabidopsis thaliana


Alignment Length:229 Identity:58/229 - (25%)
Similarity:92/229 - (40%) Gaps:51/229 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 EEEISRDP---LIW----LYHDVIYDSEIAQL------TNVTREEMIL--GTTTNYTTPDRVNRL 356
            ||.|...|   |.|    :|......:|..|.      .|:....:.|  |.|...|...|.:..
plant    70 EESIGSIPFQVLSWRPRAIYFPNFATAEQCQAIIERAKVNLKPSALALRKGETAENTKGTRTSSG 134

  Fly   357 FHIKVTDDDGGKLDKTLVNRMADISGLDVGNTTTLAR--------INYGLGGYFQEHSDYMDIKL 413
            ..|..:::..|.||  .|.|       .:...|.:.|        :.|.||..:..|.|..:...
plant   135 TFISASEESTGALD--FVER-------KIARATMIPRSHGESFNILRYELGQKYDSHYDVFNPTE 190

  Fly   414 Y-PELTEEGDRLMTFLFYMTDVPVGGTTIFP---GAQ------------LAIQPKKGSALFWYNL 462
            | |:.::   |:.:||.|::||..||.|:||   |:.            |.::|:||..|.:|::
plant   191 YGPQSSQ---RIASFLLYLSDVEEGGETMFPFENGSNMGIGYDYKQCIGLKVKPRKGDGLLFYSV 252

  Fly   463 HNNGDPNLLTRHAVCPTIVGSRWVLVKSMLNYEQ 496
            ..||..:..:.|..||...|.:||..|.:.:.:|
plant   253 FPNGTIDQTSLHGSCPVTKGEKWVATKWIRDQDQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 49/196 (25%)
AT4G33910NP_567941.1 PLN00052 66..287 CDD:177683 58/229 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.