DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and AT4G25600

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_194290.2 Gene:AT4G25600 / 828665 AraportID:AT4G25600 Length:291 Species:Arabidopsis thaliana


Alignment Length:213 Identity:48/213 - (22%)
Similarity:88/213 - (41%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 IAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTTPDRVNRLFHIKVTDDDG 366
            :.|.:..::|..|.::||...:.:.|...|.::.:|     ||..|:             .|.||
plant    54 VDPTRVLQLSWLPRVFLYRGFLSEEECDHLISLRKE-----TTEVYS-------------VDADG 100

  Fly   367 GKLDKTLVNRMADISGLD--VGNTTTLARINYG---LGGYFQEHS----DYMDIKLYPELTEEGD 422
                ||.::.:  ::|::  |...|.|...|.|   :..|..|.|    ||...:  |.......
plant   101 ----KTQLDPV--VAGIEEKVSAWTFLPGENGGSIKVRSYTSEKSGKKLDYFGEE--PSSVLHES 157

  Fly   423 RLMTFLFYMTDVPVGGTTIFPGAQL-----------AIQPKKGSALFWYNLHNNGDPNLLTRHAV 476
            .|.|.:.|:::...||..:||.:::           .::|.||:|:.::....|...:..:.|..
plant   158 LLATVVLYLSNTTQGGELLFPNSEMKPKNSCLEGGNILRPVKGNAILFFTRLLNASLDGKSTHLR 222

  Fly   477 CPTIVGSRWVLVKSMLNY 494
            ||.:.|.  :||.:.|.|
plant   223 CPVVKGE--LLVATKLIY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 40/184 (22%)
AT4G25600NP_194290.2 2OG-FeII_Oxy <159..237 CDD:304390 18/79 (23%)
ShKT 251..291 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.