DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and AT3G28480

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001189994.1 Gene:AT3G28480 / 822478 AraportID:AT3G28480 Length:324 Species:Arabidopsis thaliana


Alignment Length:298 Identity:66/298 - (22%)
Similarity:112/298 - (37%) Gaps:90/298 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 LSQDPNNSLVHLRPRKSPTMIEQGCQGKFPPGPQLVCRYNSTTTPFMRIAPLKEEEISRDPLIWL 318
            :|..||..|......:..::|:.                 .|:.......|.:..::|..|.::|
plant    20 ISSAPNRFLTRSSNTRDGSVIKM-----------------KTSASSFGFDPTRVTQLSWTPRVFL 67

  Fly   319 YHDVIYDSEIAQLTNVTREEMILGTTTNYTTPDRVNRLFHIKVTDDDGGKL----DKTLVNR--- 376
            |...:.|.|......:.:                 .:|....|.|:|.|:.    |...|.|   
plant    68 YEGFLSDEECDHFIKLAK-----------------GKLEKSMVADNDSGESVESEDSVSVVRQSS 115

  Fly   377 --MADISGLDVG-------------------NTTTLARINYGLGGYFQEHSDYMDIKLYPELTEE 420
              :|::..|::.                   |..::..::|..|..::.|.||...:...||  .
plant   116 SFIANMDSLEIDDIVSNVEAKLAAWTFLPEENGESMQILHYENGQKYEPHFDYFHDQANLEL--G 178

  Fly   421 GDRLMTFLFYMTDVPVGGTTIFP-----GAQL-------------AIQPKKGSALFWYNLHNNGD 467
            |.|:.|.|.|:::|..||.|:||     ..||             |::|:||.||.::|||.|..
plant   179 GHRIATVLMYLSNVEKGGETVFPMWKGKATQLKDDSWTECAKQGYAVKPRKGDALLFFNLHPNAT 243

  Fly   468 PNLLTRHAVCPTIVG-----SRWVLVKSMLNYEQMFKK 500
            .:..:.|..||.:.|     :||:.|||   :|:.|.|
plant   244 TDSNSLHGSCPVVEGEKWSATRWIHVKS---FERAFNK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 49/215 (23%)
AT3G28480NP_001189994.1 PLN00052 51..324 CDD:177683 60/250 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.