DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and P4H2

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_566279.1 Gene:P4H2 / 819804 AraportID:AT3G06300 Length:299 Species:Arabidopsis thaliana


Alignment Length:246 Identity:63/246 - (25%)
Similarity:103/246 - (41%) Gaps:63/246 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 LVCRYNST---TTPFMRIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTT 349
            ||...:||   ::|...|.|.|.:::|..|..::|...:.|.|...|.::.:|            
plant    16 LVLLQSSTCLISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLAKE------------ 68

  Fly   350 PDRVNRLFHIKVTDDDGGK--------LDKTLVNRMAD--ISGLD--VGNTTTLARIN------- 395
                 .|....|.|:|.|:        ...|.:::..|  :||::  :...|.|.:.|       
plant    69 -----NLQRSAVADNDNGESQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVL 128

  Fly   396 -YGLGGYFQEHSDYMDIKLYPELTEEGDRLMTFLFYMTDVPVGGTTIFPGAQ------------- 446
             |..|..:..|.||...|:  .:...|.|:.|.|.|:::|..||.|:||.||             
plant   129 RYEHGQKYDAHFDYFHDKV--NIARGGHRIATVLLYLSNVTKGGETVFPDAQEFSRRSLSENKDD 191

  Fly   447 --------LAIQPKKGSALFWYNLHNNGDPNLLTRHAVCPTIVGSRWVLVK 489
                    :|::||||:||.::||..:..|:..:.|..||.|.|.:|...|
plant   192 LSDCAKKGIAVKPKKGNALLFFNLQQDAIPDPFSLHGGCPVIEGEKWSATK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 51/205 (25%)
P4H2NP_566279.1 P4Hc 55..245 CDD:214780 52/207 (25%)
ShKT 259..299 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.