DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and AT-P4H-1

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_181836.1 Gene:AT-P4H-1 / 818910 AraportID:AT2G43080 Length:283 Species:Arabidopsis thaliana


Alignment Length:223 Identity:56/223 - (25%)
Similarity:86/223 - (38%) Gaps:32/223 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 NSTTTPFMRIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTTPDRVNR-- 355
            |......:||..:|.|.:|..|.|.:.||.:...|...|..:.|..:.:.|..:..|...|..  
plant    63 NDKDAELLRIGNVKPEVVSWSPRIIVLHDFLSPEECEYLKAIARPRLQVSTVVDVKTGKGVKSDV 127

  Fly   356 -------LFHIKVTDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKL 413
                   |.|:    :....:.:.:..|:|..|.:...|...:..:.|....:::.|.||.....
plant   128 RTSSGMFLTHV----ERSYPIIQAIEKRIAVFSQVPAENGELIQVLRYEPQQFYKPHHDYFADTF 188

  Fly   414 YPELTEEGDRLMTFLFYMTDVPVGGTTIFPGA-------------QLAIQPKKGSA-LFW-YNLH 463
              .|...|.|:.|.|.|:||...||.|.||.|             .::::|.||.| ||| ..|.
plant   189 --NLKRGGQRVATMLMYLTDDVEGGETYFPLAGDGDCTCGGKIMKGISVKPTKGDAVLFWSMGLD 251

  Fly   464 NNGDPNLLTRHAVCPTIVGSRWVLVKSM 491
            ...||..:  |..|..:.|.:|...|.|
plant   252 GQSDPRSI--HGGCEVLSGEKWSATKWM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 44/188 (23%)
AT-P4H-1NP_181836.1 PLN00052 80..281 CDD:177683 51/206 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.