DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and P4H5

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_179363.1 Gene:P4H5 / 816281 AraportID:AT2G17720 Length:291 Species:Arabidopsis thaliana


Alignment Length:219 Identity:57/219 - (26%)
Similarity:94/219 - (42%) Gaps:54/219 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 EEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTT----PDRVN-------RLFHIKV 361
            |.||.:|...:||:.:.:.|...|.::.:..|:..|..:..|    ..||.       |..|.:|
plant    81 EVISWEPRAVVYHNFLTNEECEHLISLAKPSMVKSTVVDEKTGGSKDSRVRTSSGTFLRRGHDEV 145

  Fly   362 TDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPELTE-----EG 421
            .:        .:..|::|.:.:.|.|...|..::|.:|..::.|.||.       |.|     .|
plant   146 VE--------VIEKRISDFTFIPVENGEGLQVLHYQVGQKYEPHYDYF-------LDEFNTKNGG 195

  Fly   422 DRLMTFLFYMTDVPVGGTTIFPGAQ-------------------LAIQPKKGSALFWYNLHNNG- 466
            .|:.|.|.|::||..||.|:||.|:                   |::.|||..||.::|:..:. 
plant   196 QRIATVLMYLSDVDDGGETVFPAARGNISAVPWWNELSKCGKEGLSVLPKKRDALLFWNMRPDAS 260

  Fly   467 -DPNLLTRHAVCPTIVGSRWVLVK 489
             ||:.|  |..||.:.|::|...|
plant   261 LDPSSL--HGGCPVVKGNKWSSTK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 50/201 (25%)
P4H5NP_179363.1 PLN00052 75..290 CDD:177683 57/219 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 0.514 Domainoid score I2609
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.930

Return to query results.
Submit another query.