DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and P4HA1

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_000908.2 Gene:P4HA1 / 5033 HGNCID:8546 Length:534 Species:Homo sapiens


Alignment Length:541 Identity:143/541 - (26%)
Similarity:241/541 - (44%) Gaps:108/541 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YSNSIRALSELREIENSYMEHLNNYVSFLQQKIKTLRIFINSLTPNYLDHKVDRYKYVSNPLNSF 101
            :..||..:::|...|...:..|.:|:...:.|::.::.:...|.........|...:|.:|:|:|
Human    21 FFTSIGQMTDLIHTEKDLVTSLKDYIKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAF 85

  Fly   102 GLLRRAHQDWPKL-IAYLKDQGNIKVDIEEMNKLINRTPHANDMEE--ALMGMDRIEHFYDLKSS 163
            .|::|.:.:|.:| ...|||..:..:.    |..|.|....||.::  |...:.|::..|:|.:.
Human    86 KLMKRLNTEWSELENLVLKDMSDGFIS----NLTIQRQYFPNDEDQVGAAKALLRLQDTYNLDTD 146

  Fly   164 DMAQGLVAGQQLSSRMSASDCLALADYMYKRSEFRRAAEWYRIALSVFTKPKNNIAFKFYAPKRK 228
            .:::|.:.|.:..|.::|.||..|....|..:::.....|...||....:.:.:           
Human   147 TISKGNLPGVKHKSFLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEIS----------- 200

  Fly   229 ELEKMFVISRL-----QEGSVEN---LTDCLKELS---QDPNNSLVHLR---------------- 266
            .::|:.|:..|     |:|.::.   ||..|.||.   |..|.:|.:..                
Human   201 TIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKDVNKSASDD 265

  Fly   267 -------PRKSPTMI---------EQGCQG---KFPPGPQ--LVCRY-NSTTTPFMRIAPLKEEE 309
                   |:|....:         |..|:|   |..|..|  |.||| :....|...:||.|:|:
Human   266 QSDQKTTPKKKGVAVDYLPERQKYEMLCRGEGIKMTPRRQKKLFCRYHDGNRNPKFILAPAKQED 330

  Fly   310 ISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTTPDRVNRLFHIKVTDDDGGKL----- 369
            ....|.|..:||:|.|:||..:.::.:.                 ||....|.|.:.|||     
Human   331 EWDKPRIIRFHDIISDAEIEIVKDLAKP-----------------RLSRATVHDPETGKLTTAQY 378

  Fly   370 -----------DKTLVN----RMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPELTE 419
                       :..:|:    |:.|::||||.....|...|||:||.::.|.|:.. |..|:..:
Human   379 RVSKSAWLSGYENPVVSRINMRIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFAR-KDEPDAFK 442

  Fly   420 E---GDRLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGDPNLLTRHAVCPTIV 481
            |   |:|:.|:||||:||..||.|:||....::.||||:|:|||||..:|:.:..||||.||.:|
Human   443 ELGTGNRIATWLFYMSDVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLV 507

  Fly   482 GSRWVLVKSMLNYEQMFKKPC 502
            |::||..|.:....|.|::||
Human   508 GNKWVSNKWLHERGQEFRRPC 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 30/132 (23%)
P4Hc 324..489 CDD:214780 63/187 (34%)
P4HA1NP_000908.2 P4Ha_N 25..112 CDD:400573 19/86 (22%)
TPR 205..238 9/32 (28%)
P4Hc 345..518 CDD:214780 64/190 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D192165at33208
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.