DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and CG4174

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001034031.2 Gene:CG4174 / 40023 FlyBaseID:FBgn0036793 Length:473 Species:Drosophila melanogaster


Alignment Length:548 Identity:134/548 - (24%)
Similarity:241/548 - (43%) Gaps:137/548 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FHYILLNWILLFLFTVCKAKKAENDVVQE------VIYSNSIRALSELREIENSYMEHLNNYVSF 64
            ||::::        |.|...:.:.:||..      .|.|.|..:|.:|:|   :::.:|.:|...
  Fly     3 FHFVVV--------TACLGFQVKGEVVSAPESYDFAISSESQLSLLKLKE---THVNNLQSYKKV 56

  Fly    65 LQQKIKTLRIFINSLTPNYLDHKVDRYKYVSNPLN---SFGLLRRAHQDWPKLIAYL-KDQGNIK 125
            |::.::.:|..|..........|       ::|.|   .:.:||..|.|||:....| ||.|..:
  Fly    57 LKKHLQKIRRAIRQSEELLKSTK-------TSPRNLIYGYKVLRHLHNDWPQYFRLLKKDLGLEQ 114

  Fly   126 VDIEEMNKLINRTPHANDMEEALMGMDRIEHFYDLKSSDMAQGLVAGQQLSSR-MSASDCLALA- 188
            :.:.:|  |:.:.|.:.|.||::..|.|::..|:|.|..|.:|.:..:..:.| .||.:||.|. 
  Fly   115 IAVSQM--LLTQQPTSVDFEESMGAMHRLQTVYNLDSYAMTEGFIDDKDKNIRNWSADECLMLGL 177

  Fly   189 DYMYKRSEFRRAAEWYRIALSVFTKPKNNIAFKFYAPKRKELEKMFVISRLQEGSVENLTDCLKE 253
            .|::.: ::.::..|..:||..:   .:|:     :|:         :.:::..:..||.:.|.|
  Fly   178 MYLFLK-DYNQSENWLELALYHY---DDNV-----SPE---------VLKIKLWNYPNLLESLVE 224

  Fly   254 ------------------LSQDPNNS--------LVHL--------RPRKSPTMIEQGCQGKF-P 283
                              ||.:||::        |.||        :|:|...:.::.|..:: .
  Fly   225 ANKGLGHYFEAKKYANELLSINPNHTYMLTQLPKLKHLQSNPAKLTKPKKVFQLQKEICSKRYRR 289

  Fly   284 PGPQLVCRYNSTTTPFMRIAPLKEEEISRDPLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYT 348
            ....||||| ...|||:::||||.||:|..|.|.:::..:...:|..|.||:|            
  Fly   290 KSGVLVCRY-VDWTPFLKLAPLKMEELSMKPYISIFYGFLGQKDIEVLKNVSR------------ 341

  Fly   349 TPDRVNRLFHI------KVTDDDGGKLDKTL------VNRM-ADISGLDVGNTTTLARINYGLGG 400
              .::.|:.|:      |:     |.|..:|      ||.: ..|:|..:.....|..||||:.|
  Fly   342 --PKLQRIEHLSGNCSCKI-----GNLSTSLHDVVRKVNELILGITGFPLKGNQMLEVINYGIAG 399

  Fly   401 YFQEHSDYMDIKLYPELTEEGDRLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNN 465
            .:.           ||..:..::...|:| :::...||..:||...|.::|:|||.|.|.||..:
  Fly   400 NYN-----------PEEPKIHNKANAFIF-LSNAGKGGEIVFPSRHLKVRPRKGSMLVWENLKKS 452

  Fly   466 GDPNLLTRHAVCPTIVGSRWVLVKSMLN 493
                 |..|. ||.:.|:.||..| :||
  Fly   453 -----LIYHQ-CPILKGNMWVANK-VLN 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 35/133 (26%)
P4Hc 324..489 CDD:214780 45/177 (25%)
CG4174NP_001034031.2 P4Ha_N 33..157 CDD:285528 36/135 (27%)
TPR repeat 169..197 CDD:276809 7/28 (25%)
TPR repeat 202..245 CDD:276809 7/56 (13%)
2OG-FeII_Oxy <362..470 CDD:304390 35/125 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I2378
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28396
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.