DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and CG34041

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001034077.5 Gene:CG34041 / 3885583 FlyBaseID:FBgn0054041 Length:568 Species:Drosophila melanogaster


Alignment Length:337 Identity:78/337 - (23%)
Similarity:153/337 - (45%) Gaps:58/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VVQEVIYSNS--IRALSE-----LREIENSYMEHLNNYVSFLQQKIKTLRIFINSLTPNYLDHKV 88
            ::..:.||||  ..:||:     :.:|:.:.:::|.||:..|:.|:||:...:..|...::..:.
  Fly   244 IIVYLSYSNSENRHSLSKSKVINILKIQENVVKYLENYIYALETKLKTIDEALIDLATYHIQFER 308

  Fly    89 DRYKYVSNPLNSFGLLRRAHQDWPKLIAYL-KDQGNIKVDIEEMNKLINRTPHANDMEEALMGMD 152
            |:....|:|:.|:.|:.....||.....:| :|.|  |.::..:..:....|..||:.|...|:.
  Fly   309 DKLAIASSPVASYSLIHHMQSDWTHWQLFLQEDPG--KDELASLMSIKKYLPTKNDISEVCHGIS 371

  Fly   153 RIEHFYDLKSSDMAQGLVAGQQ---LSSR----------------MSASDCLALADYMYKRSEFR 198
            ::.:.|.:.:.|:|.|::.|.|   :||.                ||..||:||:|:..:..::.
  Fly   372 KMLNAYLMTAQDIANGVILGTQTKYISSALKLEYLYMEIICNRHLMSLRDCVALSDHSMEMKDYN 436

  Fly   199 RAAEWYRIALSVFTK--------PKNNIAFKFYAPKRKELEKMFVISRLQEGSVENLTDCLKELS 255
            ::.||..:|:|:...        |..::..|        |.:::|..:....::|.:...||  |
  Fly   437 KSKEWLNVAISMLESSAYWDPIVPSADLYLK--------LAEVYVKQQNWTLALETVEFALK--S 491

  Fly   256 QDPNNSLVHLR----------PRKSPTMIEQGCQGKFPPGPQLVCRYNSTTTPFMR-IAPLKEEE 309
            ...|..|:.::          |.|||.:..:....:......|.|.|::....|.. :||:|.|.
  Fly   492 NPRNAQLIRMQKRLSYHILLGPPKSPKLNIENNDYRLRKNGSLYCFYDTKIRTFYSLLAPIKAEV 556

  Fly   310 ISRDPLIWLYHD 321
            :..|||:.|||:
  Fly   557 LFIDPLVILYHE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 32/137 (23%)
P4Hc 324..489 CDD:214780
CG34041NP_001034077.5 P4Ha_N 29..138 CDD:285528
P4Ha_N 260..389 CDD:285528 30/130 (23%)
TPR repeat 452..491 CDD:276809 7/48 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461973
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000199
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10869
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.