DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and P4htm

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_217285.7 Gene:P4htm / 301008 RGDID:1311848 Length:503 Species:Rattus norvegicus


Alignment Length:369 Identity:68/369 - (18%)
Similarity:108/369 - (29%) Gaps:174/369 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 PGPQLVCRYNSTTTPFMRIAPLKEEE----------------------ISRDPLIWLYHDVIYDS 326
            ||||   |...:..|...:.||...|                      :|..||::.....:.|.
  Rat    94 PGPQ---RREQSPQPVPTLGPLTRLEGIKVGYERKVQVVAGRDHFIRTLSLKPLLFEIPGFLSDE 155

  Fly   327 E------IAQLTNVTREEM------------------------------------ILGTTT---- 345
            |      :||:..:.|.::                                    :|..|.    
  Rat   156 ECRLIIHLAQMKGLQRSQILPTEEYEEAMSAMRVSQLDLFQLLDQNHDGRLQLREVLAQTRLGNG 220

  Fly   346 NYTTPDRVNRLFHIKVTDDDG---------GKLD------------------------------- 370
            .:.||:.:..::.....|.||         ..:|                               
  Rat   221 RWMTPENIQEMYSAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSHKAESSELVRNSHHTWLHQGE 285

  Fly   371 ---------KTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPELT-------- 418
                     :..|.|:..:|...|..:..|..:.||.||::..|.|...:  |||..        
  Rat   286 GAHHVMRAIRQRVLRLTRLSPEIVELSEPLQVVRYGEGGHYHAHVDSGPV--YPETVCSHTKLVA 348

  Fly   419 ------EEGDRLMTFLFYMTDVPVGGTTIFPGA---------------------------QLAIQ 450
                  |...|.||.|||:.:|..||.|:||.|                           .|.::
  Rat   349 NESVPFETSCRYMTVLFYLNNVTGGGETVFPVADNRTYDEMSLIQDNVDLRDTRRHCDKGNLRVK 413

  Fly   451 PKKGSALFWYNLHNNG--------DPNLLTRHAVCPTIVGSRWV 486
            |::|:|:||||...:|        |.:|   |..|....|::|:
  Rat   414 PQQGTAVFWYNYLPDGQGWVGEVDDYSL---HGGCLVTRGTKWI 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 56/307 (18%)
P4htmXP_217285.7 EF-hand_7 193..253 CDD:404394 7/59 (12%)
P4Hc 247..459 CDD:214780 44/213 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.