DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and phy-3

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_507251.2 Gene:phy-3 / 188624 WormBaseID:WBGene00004026 Length:318 Species:Caenorhabditis elegans


Alignment Length:198 Identity:44/198 - (22%)
Similarity:91/198 - (45%) Gaps:18/198 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PLKEEEISRDPLIWLYHDVIYDSEIAQLTN-VTREEMILGTTTNY-----TTPDRVNRLFHIKVT 362
            |:..|.||..|.:.:|.:::...:.|...| :.:.::.:..|:::     ||..|.|..|   :.
 Worm    82 PVDMEIISWAPTLVIYRNLMSPRQTASFLNFIEQRDLEIQKTSDFGTSIETTHRRANGSF---IP 143

  Fly   363 DDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDYMDIKLYPE----LTEEGDR 423
            .:|.....:..:.....|.||::......:.::|..||::..|.||:|.:...:    :.:.|:|
 Worm   144 PEDSNVTVEIKMQAQKRIPGLNLTVAEHFSALSYLPGGHYAVHYDYLDYRSKQDYDWWMNKTGNR 208

  Fly   424 LMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGDPNLLTRHAVCP-----TIVGS 483
            :.|.:|.:.....||.|:||.....::...|.|.||:|...:.:..:|:.|..||     .::.:
 Worm   209 IGTLIFVLKPAEKGGGTVFPSIGSTVRANAGDAFFWFNAQADEEKEMLSNHGGCPIYEGRKVIAT 273

  Fly   484 RWV 486
            .|:
 Worm   274 IWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 38/178 (21%)
phy-3NP_507251.2 P4Hc 102..277 CDD:214780 38/178 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.