DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and C14E2.4

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:NP_001359861.1 Gene:C14E2.4 / 182616 WormBaseID:WBGene00015773 Length:311 Species:Caenorhabditis elegans


Alignment Length:232 Identity:48/232 - (20%)
Similarity:84/232 - (36%) Gaps:66/232 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 LKEEEISRDPLIWLYHDVIYDSEIAQ----LTNVTREEMILGTTTNYTTPDRVNRLFHIKVTDDD 365
            ::.|.:|..|.:.:|.||....:::.    |.|:...|.                    ||..||
 Worm    81 VRMEILSWSPPLVIYRDVFSKKQVSDYLELLKNLKMNEQ--------------------KVVRDD 125

  Fly   366 G-----------GKLDKTLVNRMADISGL-----------DVGNTTTLARINYGLGGYFQEHSDY 408
            |           |.:  |..:..|:...|           |...|..::.::|..||::..|:|:
 Worm   126 GEIAYSTYRQANGTI--TPAHSHAEAQSLMDTATQLLPVFDFQYTEQISALSYIKGGHYALHTDF 188

  Fly   409 MDIKLYPE----LTEEGDRLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGDPN 469
            :......:    ..|.|:||.||:........||.|:||......:...|.|..|:|.:.|.:..
 Worm   189 LTFANAEDSNRHFGEMGNRLATFIMVFKKAEKGGGTLFPQLGNVFRANPGDAFLWFNCNGNLERE 253

  Fly   470 LLTRHAVCP-----TIVGSRWVLVKSMLNYEQMFKKP 501
            ..:.|..||     .|:.:.|:         ::|.:|
 Worm   254 AKSLHGGCPIRAGEKIIATIWI---------RIFNQP 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 40/199 (20%)
C14E2.4NP_001359861.1 P4Hc 100..276 CDD:214780 40/206 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.