DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and LOC110438249

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_021324927.1 Gene:LOC110438249 / 110438249 -ID:- Length:229 Species:Danio rerio


Alignment Length:230 Identity:81/230 - (35%)
Similarity:123/230 - (53%) Gaps:28/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 QLVCRY-NSTTTPFMRIAPLKEEEISRD-PLIWLYHDVIYDSEIAQLTNVTREEMILGTTTNYTT 349
            :||||| .....|.|    |.:||:..| |:|..|||.:.:.||..:..:.|.::......:..:
Zfish     8 KLVCRYRRGRGNPLM----LFKEEVEWDQPMILRYHDFLSEGEIDTIKTLARPKLSRAQVIDAVS 68

  Fly   350 PDRVNRLFHIKVT-----DDDGGKLDKTLVN-RMADISGLDVGNTTTLARINYGLGGYFQEHSDY 408
            ..||:....:..:     |:|.   ..|.|| |:||::||::....:|...|||:||.::.|.| 
Zfish    69 GKRVSAASRVSQSAWLYEDEDP---VVTQVNQRIADVTGLELQTAESLQIANYGIGGQYEPHYD- 129

  Fly   409 MDIKLYPELTEEGD------RLMTFLFYMTDVPVGGTTIFPGAQLAIQPKKGSALFWYNLHNNGD 467
                  .:||.:.|      |:.|.|.||:||.:||.|:||....|:|||:|||:.|:||..||:
Zfish   130 ------SKLTNDSDFQLRGGRIATVLIYMSDVDIGGATVFPDVGAALQPKRGSAVLWFNLLRNGN 188

  Fly   468 PNLLTRHAVCPTIVGSRWVLVKSMLNYEQMFKKPC 502
            .::.|.||.||..|||:||..|.:..|.|.|::.|
Zfish   189 EDIRTLHAACPVFVGSKWVANKWIRTYGQEFRRKC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 60/176 (34%)
LOC110438249XP_021324927.1 PLN00052 28..218 CDD:177683 68/199 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.