DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and st18

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_017950383.1 Gene:st18 / 100489306 XenbaseID:XB-GENE-984591 Length:1025 Species:Xenopus tropicalis


Alignment Length:280 Identity:55/280 - (19%)
Similarity:89/280 - (31%) Gaps:109/280 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KKAENDVVQEVIYSNSIRALSELREIENSYMEHLNNYVSFLQQKIKTLRIFINSLTPNYLDHKVD 89
            ||..|.|...|:.|..:...|  .|.::.|.:.::| .|.|:...|                   
 Frog    88 KKCGNTVGGMVLQSARVECHS--TEEKHCYQDIMSN-ASILRNAAK------------------- 130

  Fly    90 RYKYVSNPLNSFGLLRRAHQDWPKLIAYLKDQG--NIKVDIEEMNKLINRTPHANDMEEALMGMD 152
              :.:.||||..                :.|.|  ::|.|.::..:.....|..:...:|....|
 Frog   131 --ETIMNPLNDI----------------INDSGTQSVKADTDDAQESYCDQPSKHKDHQAFSADD 177

  Fly   153 R------IEHFYDLKSSDMAQGLVAGQQLSSRMSASDCLALADYMYKRSEFRRAAEWYRIALSVF 211
            .      .|:.:|..||           .|..|:|:|        :...|:.:            
 Frog   178 TNSNCEITENGWDSSSS-----------FSEEMNAND--------HSPDEYSK------------ 211

  Fly   212 TKPKNNIAFKFYAPKRKELEKMFVIS---------------RLQEGSVENLTD-----CLKELSQ 256
             |.|.|....|   |::..:|..|..               :.|...:||..|     .|||.|.
 Frog   212 -KMKINPTVDF---KKRSTDKGDVCETQSNSVIQATEQEDRKTQHSKLENEEDDKCLSALKEESV 272

  Fly   257 DPNNSLVHLRPRKSPTMIEQ 276
            |.||:      :.|.|::||
 Frog   273 DLNNT------KGSLTLLEQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528 22/137 (16%)
P4Hc 324..489 CDD:214780
st18XP_017950383.1 zf-C2HC 345..371 CDD:366692
zf-C2HC 389..417 CDD:366692
MYT1 457..693 CDD:369895
zf-C2HC 701..729 CDD:366692
zf-C2HC 745..773 CDD:366692
zf-C2HC 793..821 CDD:366692
zf-C2HC 847..873 CDD:366692
Com_YlbF 901..984 CDD:382561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.