DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34345 and p4htm

DIOPT Version :9

Sequence 1:NP_001097101.1 Gene:CG34345 / 5740402 FlyBaseID:FBgn0085374 Length:504 Species:Drosophila melanogaster
Sequence 2:XP_002933103.2 Gene:p4htm / 100486123 XenbaseID:XB-GENE-950282 Length:505 Species:Xenopus tropicalis


Alignment Length:319 Identity:69/319 - (21%)
Similarity:112/319 - (35%) Gaps:132/319 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 ELEKMFVISRLQEG---SVENLTDCLKELSQDPN-NSLVHLRPRKSPTMIEQGCQGKFPPGPQLV 289
            :::::...|||..|   :.||:.:....|..||: |.::.|...|...:.:              
 Frog   210 QIKEVLTHSRLGNGRWMTPENIREMYSALRADPDGNGVLSLDEFKKLNLRD-------------- 260

  Fly   290 CRYNSTTTPFMRIAPLKEEEISRDPLI------WLY-----HDVIYDSEIAQLTNVTREEMILGT 343
                     |.:.  |.::|::...|:      |||     |.|:  ..|.|             
 Frog   261 ---------FHKY--LGKQEVTMSDLVRNSHHTWLYQGEGAHHVL--RSIRQ------------- 299

  Fly   344 TTNYTTPDRVNRLFHIKVTDDDGGKLDKTLVNRMADISGLDVGNTTTLARINYGLGGYFQEHSDY 408
                    ||.:|.|:.:                 ||    |.|:..|..:.|..||::..|.|.
 Frog   300 --------RVIKLTHLPL-----------------DI----VENSEPLQVVRYDTGGHYHAHMDS 335

  Fly   409 MDIKLYPE-------LT-------EEGDRLMTFLFYMTDVPVGGTTIFPGA-------------- 445
            ..:  :||       ||       |...|.:|.|||:.:|..||.|.||.|              
 Frog   336 GPV--FPETACTHTKLTTNETAPFETSCRYVTVLFYLNNVTGGGETTFPVADNRTYEELSLIQND 398

  Fly   446 -------------QLAIQPKKGSALFWYNLHNN-----GDPNLLTRHAVCPTIVGSRWV 486
                         .|.|:|::|:|:||||..::     ||.:....|..|....|::|:
 Frog   399 VDLRDTRKHCDKGNLRIKPRQGTAVFWYNYLSDGKGWVGDVDEFALHGGCLVTAGTKWI 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34345NP_001097101.1 P4Ha_N 40..170 CDD:285528
P4Hc 324..489 CDD:214780 48/209 (23%)
p4htmXP_002933103.2 EF-hand_7 196..256 CDD:372618 12/45 (27%)
P4Hc 273..462 CDD:214780 54/231 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1438683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.