DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34164 and WDY

DIOPT Version :10

Sequence 1:NP_001097152.1 Gene:CG34164 / 5740394 FlyBaseID:FBgn0085193 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_563902.4 Gene:WDY / 3290597 VectorBaseID:AGAMI1_009209 Length:1059 Species:Anopheles gambiae


Alignment Length:38 Identity:12/38 - (31%)
Similarity:17/38 - (44%) Gaps:1/38 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKEPILGKH-FALPGRIEQSPPIELDTSQSYIAVYTHL 61
            |.||||... ..||.:......|:||.:.....:|.|:
Mosquito   972 LAEPILNTAVLKLPSKEPMLQTIKLDRTYPSFPLYRHM 1009

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34164NP_001097152.1 None
WDYXP_563902.4 WD40 repeat 132..170 CDD:293791
WD40 repeat 176..214 CDD:293791
WD40 repeat 219..263 CDD:293791
WD40 repeat 271..334 CDD:293791
WD40 348..638 CDD:475233
WD40 repeat 350..387 CDD:293791
WD40 repeat 392..428 CDD:293791
WD40 repeat 436..474 CDD:293791
WD40 repeat 481..519 CDD:293791
WD40 repeat 527..559 CDD:293791
WD40 533..878 CDD:475233
WD40 repeat 576..614 CDD:293791
WD40 repeat 621..646 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.